2
$\begingroup$

I'm trying to download around 2000 proteomes from NCBI, but all I have is the genus and species e.g: lophodermium_seditiosum trichoderma_harzianum

Does anyone know a good way of doing this in script form?
My code at the moment is:

from Bio import Entrez
from Bio import SeqIO
import os

file_name = "proteome1.faa"
net_handle = Entrez.efetch(db="protein", id="trichoderma_harzianum", rettype="gp", retmode="text")
out_handle = open(file_name, "w")
out_handle.write(net_handle.read())
out_handle.close()
net_handle.close()
print("Saved")


for seq_record in SeqIO.parse("proteome1.faa", "genbank"):
    print(seq_record.id)
    print(repr(seq_record.seq))
    print(len(seq_record))

But I think it wants a number as the id, I don't know if it's possible to convert species name to a numerical ID within the script, or if that's the best way of going about this.

$\endgroup$
1
  • $\begingroup$ So when I implement the get_proteomes, it is returning only the first page of the protein sequence. Is there a way I can download the whole proteome of the specific genus? If so, how should I go about it? Really, a noob in python programming. Thank you $\endgroup$ 2 days ago
2
$\begingroup$

The general procedure is explained here:

First step is to search the Taxonomy database with the organism name. Accepted common names usually work at all taxonomic levels. Use the scientific name or formal name if no results are obtained with the common name.

In code:

from Bio import Entrez

Entrez.email = 'user@example.org' # Put your email here

def get_tax_id(species):
    species = species.replace('_', '+').strip()
    search = Entrez.esearch(term=species, db='taxonomy', retmode='xml')
    record = Entrez.read(search)
    return record['IdList'][0]

if __name__ == '__main__':
    organisms = ['lophodermium_seditiosum', 'trichoderma_harzianum']
    taxids = [get_tax_id(organism) for organism in organisms]
    print(taxids)

This gives us the taxids for our species, respectively 128023and 5544. Now we can use thes to get the proteomes. For Lophodermium seditiosum we find two results, but for Trichoderma harzianum there are 65900 results, so you might want to tweak the query to filter the results. For example, if you only want the sequences appearing in PDB you add AND pdb[filter] so that the query becomes txid5544[Organism:exp] AND pdb[filter].

def get_proteomes(taxid):
    query = 'txid{}[Organism:exp]'.format(taxid)
    handle = Entrez.esearch(db='protein', term=query)
    result = Entrez.read(handle)
    if int(result['Count']) <= 2000:
        ids = ','.join(result['IdList'])
        proteomes = Entrez.efetch(db='protein', id=ids, rettype='fasta').read()
        return proteomes
    else:
        raise RuntimeError('Too many results!')

if __name__ == '__main__':
    print(get_proteomes('128023'))

Returns:

>ADI44294.1 actin, partial [Lophodermium seditiosum]
CKAGFAGDDAPRAVFPSIVGRPRHHGIMIGMGQKDS

>ADI44293.1 actin, partial [Lophodermium seditiosum]
CKAGFAGDDAPRAVFPSIVGRPRHHGIMIGMGQKDS
$\endgroup$
3
  • $\begingroup$ So I'm getting a 'Supplied ID parameter is empty' error from this code, the functions are defined at the beginning and are the same as in the answer listoforganisms = [x.split('\t')[0] for x in open("OGTlist.csv").readlines()] IDlist = [] #convert to id if __name__ == '__main__': organisms = listoforganisms for organism in organisms: taxid = get_tax_id(organism) IDlist.append(taxid) print (taxid) print(get_proteomes((taxid))) $\endgroup$
    – Biomage
    Jun 22 '18 at 9:27
  • $\begingroup$ Can you post a small sample of your OGTlist.csvfile? $\endgroup$
    – BioGeek
    Jun 22 '18 at 9:40
  • 1
    $\begingroup$ Got it working with, if __name__ == '__main__': organisms = listoforganisms for organism in organisms: taxid = get_tax_id(organism) print(organism) print (taxid) stringid = str(taxid) print(get_proteomes(stringid.strip("'[]'"))) Just needed to strip the list elements to the right form $\endgroup$
    – Biomage
    Jun 22 '18 at 13:24

Your Answer

By clicking “Post Your Answer”, you agree to our terms of service, privacy policy and cookie policy

Not the answer you're looking for? Browse other questions tagged or ask your own question.