1
$\begingroup$

I came across an article which has defined 3 categories: Buried [A, L, F, C, G, I, V, W], Exposed [ R, K, Q, E, N, D] and Intermediate [M, S, P, T, H, Y] when analyzing the solvent accessibility of a protein. But I could not find any reference validating the claim.

Another article has come up with 4 divisions:

B=completely buried (0-4% exposed)
b=partly buried (4-25% exposed)
e=partly exposed (25-50% exposed)
E=completely exposed (50+% exposed)

Which is authentic when dealing with solvent accessibility, and which should be used? Also for the second article [B,b,e,E], which amino acid corresponds to which class?

$\endgroup$
  • $\begingroup$ "All models are wrong but some are useful" is usually used in statistics, in this case, what do you want to solve? Can't you use both of them? If it is not explained in the 2nd article or in the supplementary information it will be hard to know by us to which amino acids are in each 4 categories. Did you looked there? $\endgroup$ – llrs Jul 23 '18 at 10:50
  • 1
    $\begingroup$ @Llopis yes I looked, no mention of anything. Since it wasn't mentioned. I thought it was probably a well known fact which is why they did not cite the source, hence I asked $\endgroup$ – girl101 Jul 23 '18 at 11:02
2
$\begingroup$

There is some confusion in the question.

Solvent accessibility of a residue, i.e. the area accessible to the solvent (water), depends on the 3D structure of the protein. It's not a property of an amino-acid (chemical compound such as alanine, leucine, ...).

There may be a correlation -- amino-acids with hydrophobic side chains are more likely to be buried, but in general amino-acids (chemical compounds) cannot be classified as buried or exposed.

I don't have access to the first article, but I tried running the prediction server described in the second linked article, and I got a result

GSGMQIFVKTFRDRLRNLLPQTITLEVEPSDTIENVKAKIQDKEGIPPDQQVLIFSRKRL
CCCCEEEEEECEEEEEECCCCEEEEEECCCCCHHHHHHHHHHHHCCCHHHEEEEECCEEC
EEEBeBbBebbEbEbEebEEeEbeBEBeeEeeBeeBbEeBeEeEEbEeEeBeBbbEEeeb

...

Porter (Secondary Structure):
H = Helix   (DSSP classes H, G and I)
E = Strand  (DSSP classes E and B)
C = Coil    (DSSP classes S, T and .)

PaleAle (Relative Solvent Accessibility):
B = very buried      (<=4% accessible)
b = somewhat buried  (>4% and <=25% accessible)
e = somewhat exposed (>25% and <=50% accessible)
E = very exposed     (>50% accessible)

In one place in the sequence you can see QQ, predicted as eB. So clearly glutamine is NOT assigned to a particular RSA class.

Dividing RSA (relative solvent accessibility, 0-100%) into categories is arbitrary, I don't think there is any widely used convention. The easiest way would be to just use numeric values.

$\endgroup$

Your Answer

By clicking “Post Your Answer”, you agree to our terms of service, privacy policy and cookie policy

Not the answer you're looking for? Browse other questions tagged or ask your own question.